General Information

  • ID:  hor005497
  • Uniprot ID:  P81206
  • Protein name:  Crustacean hyperglycemic hormone isoform 1
  • Gene name:  NA
  • Organism:  Macrobrachium rosenbergii (Giant fresh water prawn)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macrobrachium (genus), Palaemonidae (family), Palaemonoidea (superfamily), Caridea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCRRGCYQNLVFRQCIQDLQLMDDLDEYANAVQV
  • Length:  71(1-71)
  • Propeptide:  AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCRRGCYQNLVFRQCIQDLQLMDDLDEYANAVQV
  • Signal peptide:  NA
  • Modification:  T71 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P81206-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P81206-F1.pdbhor005497_AF2.pdbhor005497_ESM.pdb

Physical Information

Mass: 968052 Formula: C368H578N102O111S7
Absent amino acids: HTW Common amino acids: D
pI: 4.66 Basic residues: 10
Polar residues: 17 Hydrophobic residues: 24
Hydrophobicity: -33.66 Boman Index: -16247
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.97
Instability Index: 3463.1 Extinction Coefficient cystines: 7825
Absorbance 280nm: 111.79

Literature

  • PubMed ID:  10404650
  • Title:  Purification and characterization of an isoform of crustacean hyperglycemic hormone from the eyestalk of Macrobrachium rosenbergii.